PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G32290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 303aa    MW: 33064.2 Da    PI: 7.5788
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G32290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-093581347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      WT+eE + + +a +q   +   +W+++a++++ ++t  +++++++++
  LPERR01G32290.1 35 VWTAEENKVFEKALAQVDRDapnRWELVASMLP-RKTVIDVVNHYRDL 81
                     7*****************99*************.***********986 PP

2Myb_DNA-binding44.34.1e-14143187347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++ ++ + k++G g+W+ I+r++ + Rt+ q+ s+ qky
  LPERR01G32290.1 143 PWTEEEHKSFLMGLKKYGRGDWRNISRYFVTSRTPTQVASHAQKY 187
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.3583185IPR017884SANT domain
SMARTSM007171.6E-83284IPR001005SANT/Myb domain
SuperFamilySSF466896.9E-113489IPR009057Homeodomain-like
PfamPF002491.0E-63581IPR001005SANT/Myb domain
CDDcd001671.36E-73681No hitNo description
Gene3DG3DSA:1.10.10.602.7E-43679IPR009057Homeodomain-like
PROSITE profilePS5129417.657136192IPR017930Myb domain
SuperFamilySSF466891.17E-17138192IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-17139190IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11140186IPR009057Homeodomain-like
SMARTSM007177.6E-12140190IPR001005SANT/Myb domain
CDDcd001671.47E-10143188No hitNo description
PfamPF002491.6E-11143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MMAEAFREVL PLPYFAGQPC WYFQERRGGA GAGDVWTAEE NKVFEKALAQ VDRDAPNRWE  60
LVASMLPRKT VIDVVNHYRD LENDVGSIEA GLVPFPHYSS LSPASAFTLQ DWDASDGAFR  120
RGGGGCCLKR GRAPDQERKK GVPWTEEEHK SFLMGLKKYG RGDWRNISRY FVTSRTPTQV  180
ASHAQKYFIR LSSGGKDKRR SSIHDITTVN LPEDDAGNNP SPSPPSALTT ASDQLGAVVD  240
AKPPPPPSSI AVQRHFMSPL PGALGVSHPY GNVKIEPNAS FLAGGTGPGL DDAILLQMQC  300
GQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1431100675RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402140.0FJ940214.1 Oryza sativa Japonica Group clone KCS611H03 Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646487.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-78DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9V7X10.0A0A0D9V7X1_9ORYZ; Uncharacterized protein
STRINGOB01G46330.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-78MYB family protein